DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gus and FBXO45

DIOPT Version :9

Sequence 1:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001099043.1 Gene:FBXO45 / 200933 HGNCID:29148 Length:286 Species:Homo sapiens


Alignment Length:226 Identity:82/226 - (36%)
Similarity:138/226 - (61%) Gaps:17/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NDSQSTFKPIIPRELQADFVKPARIDILLDMPPASRDLQ-LKHSWNSEDRSLNIFVKEDDKLTFH 78
            :::...::.:..|.|..:.:   |.|||.::|.....:: .:|::::.|.|.|:::|::. .|.|
Human    73 DENSEVWRSLCARSLAEEAL---RTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNG-FTLH 133

  Fly    79 RHPVAQSTDCIRGKVGLTKGLHIWEIYW--PTRQRGTHAVVGVCTADAPLHSVGYQSLVGSTEQS 141
            |:|:|||||..|.|:|.::|.|.||::|  |.   ||.||:|:.|..||:...||.:|:||.:||
Human   134 RNPIAQSTDGARTKIGFSEGRHAWEVWWEGPL---GTVAVIGIATKRAPMQCQGYVALLGSDDQS 195

  Fly   142 WGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDEGTLSFIVDQQYLGIAFRGL 206
            |||:|..|.|.|:.:  ...::|. ..|...:.:.::..|.|||::.||:|....::||:|||||
Human   196 WGWNLVDNNLLHNGE--VNGSFPQ-CNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGL 257

  Fly   207 RGKKLYPIVSAVWGHCEITMRYIGGLDPEPL 237
            ....|||.||||:|:.|:|:.|:|    :||
Human   258 PKVCLYPAVSAVYGNTEVTLVYLG----KPL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 71/174 (41%)
SOCS_SSB1_4 234..276 CDD:239688 2/4 (50%)
FBXO45NP_001099043.1 F-box-like 38..83 CDD:372399 0/9 (0%)
SPRY_Fbox 112..286 CDD:293964 75/184 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.