DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gus and fsn-1

DIOPT Version :9

Sequence 1:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_498046.1 Gene:fsn-1 / 175667 WormBaseID:WBGene00001499 Length:332 Species:Caenorhabditis elegans


Alignment Length:193 Identity:81/193 - (41%)
Similarity:118/193 - (61%) Gaps:10/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ILLDMPPASRDLQLKH-SWNSEDRSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEI 104
            :|.::..|.:.|:..: :||:.|.|.|.:::.:. .|.||.|||||||.:|||.|::||:|.::|
 Worm   142 LLAELGSAKKKLRAWYFAWNTSDISRNNYIRTNG-FTVHRQPVAQSTDGVRGKRGISKGVHAFDI 205

  Fly   105 YW--PTRQRGTHAVVGVCTADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAIL 167
            .|  |.   ||.||||:.|..|.||.|||.:|:||.:|||||:|..|.|.|:... .|| ||. :
 Worm   206 TWDGPL---GTVAVVGIATKHAALHCVGYVALLGSDDQSWGWNLVDNVLMHNGAQ-LGV-YPK-M 264

  Fly   168 KNDEAFLVPDKFLVALDMDEGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIG 230
            .|...:.|.||..:.:|.|.....|..:.::|||||..:...:|||.|.||:|:.|:||.|:|
 Worm   265 NNPPKYEVGDKIRLIIDCDTHVAYFERNSEFLGIAFNHIPPLRLYPAVCAVYGNTEVTMVYVG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 76/175 (43%)
SOCS_SSB1_4 234..276 CDD:239688
fsn-1NP_498046.1 F-box 83..127 CDD:279040
SPRY_Fbox 158..332 CDD:293964 78/177 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D399707at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.