DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gus and fbxo45

DIOPT Version :9

Sequence 1:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_012825639.1 Gene:fbxo45 / 100216147 XenbaseID:XB-GENE-972343 Length:282 Species:Xenopus tropicalis


Alignment Length:203 Identity:81/203 - (39%)
Similarity:127/203 - (62%) Gaps:14/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIDILLDMPPASRDLQ-LKHSWNSEDRSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGLTKGLHI 101
            |.|||.::|.....:: .:|.::|.|.|.|:::|::. .|.||:|:|||||..|.|:|.::|.|.
 Frog    89 RTDILCNLPTYKAKMRAFQHGFSSSDCSRNVYIKKNG-FTLHRNPIAQSTDGARTKIGFSEGRHA 152

  Fly   102 WEIYW--PTRQRGTHAVVGVCTADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYP 164
            ||::|  |.   ||.||:|:.|..||:...||.:|:||.:|||||:|..|.|.|:.:  ...::|
 Frog   153 WEVWWEGPL---GTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGE--VNGSFP 212

  Fly   165 AILKNDEAFLVPDKFLVALDMDEGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYI 229
            . ..|...:.:.::..|.|||::.||:|....::||:|||||....|||.||||:|:.|:|:.|:
 Frog   213 Q-CNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKTCLYPAVSAVYGNTEVTLVYL 276

  Fly   230 GGLDPEPL 237
            |    :||
 Frog   277 G----KPL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 72/174 (41%)
SOCS_SSB1_4 234..276 CDD:239688 2/4 (50%)
fbxo45XP_012825639.1 F-box-like 34..79 CDD:372399
SPRY_Fbox 108..282 CDD:293964 76/184 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.