DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gus and spsb3b

DIOPT Version :9

Sequence 1:NP_001246140.1 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_021325917.1 Gene:spsb3b / 100005459 ZFINID:ZDB-GENE-121226-2 Length:334 Species:Danio rerio


Alignment Length:199 Identity:50/199 - (25%)
Similarity:87/199 - (43%) Gaps:41/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PIIPRELQADFVKPARIDILLDMPPASRDLQLK----------------HSWNSEDRSLNIFVK- 70
            |::|...::....||:.::       |.|.|:.                ..|:.||:|.::.:. 
Zfish   117 PVVPVTGESFCQCPAQTEL-------SSDAQISPYTLSCTCGEEEQGCDWVWDEEDKSSSVSLSC 174

  Fly    71 EDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPL----HSVGY 131
            .:..::||.. .:..|..|||...|:.|.|.|||...:...||..:||:.|::..|    ||  :
Zfish   175 WNRTVSFHSE-YSCGTAAIRGSKALSDGQHFWEIKMTSPVYGTDMMVGIGTSEVNLDQFKHS--F 236

  Fly   132 QSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDEGTLSFIVDQ 196
            .||:|:.|.|||... ...|:|....   |.:.:  :..:..::.    |.||...|||||..::
Zfish   237 CSLLGTDEDSWGLSY-TGHLHHKGSK---VNFSS--RFGQGSIIG----VHLDGWHGTLSFYKNR 291

  Fly   197 QYLG 200
            :.:|
Zfish   292 RCIG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gusNP_001246140.1 SPRY_SOCS1-2-4 56..229 CDD:293963 43/150 (29%)
SOCS_SSB1_4 234..276 CDD:239688
spsb3bXP_021325917.1 SPRY_SOCS3 158..>295 CDD:293936 42/149 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.