Sequence 1: | NP_001246140.1 | Gene: | gus / 35478 | FlyBaseID: | FBgn0026238 | Length: | 279 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021325917.1 | Gene: | spsb3b / 100005459 | ZFINID: | ZDB-GENE-121226-2 | Length: | 334 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 50/199 - (25%) |
---|---|---|---|
Similarity: | 87/199 - (43%) | Gaps: | 41/199 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 PIIPRELQADFVKPARIDILLDMPPASRDLQLK----------------HSWNSEDRSLNIFVK- 70
Fly 71 EDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPL----HSVGY 131
Fly 132 QSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDEGTLSFIVDQ 196
Fly 197 QYLG 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gus | NP_001246140.1 | SPRY_SOCS1-2-4 | 56..229 | CDD:293963 | 43/150 (29%) |
SOCS_SSB1_4 | 234..276 | CDD:239688 | |||
spsb3b | XP_021325917.1 | SPRY_SOCS3 | 158..>295 | CDD:293936 | 42/149 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |