Sequence 1: | NP_001036470.1 | Gene: | CG3107 / 35475 | FlyBaseID: | FBgn0033005 | Length: | 1034 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610333.1 | Gene: | CG8728 / 35748 | FlyBaseID: | FBgn0033235 | Length: | 556 | Species: | Drosophila melanogaster |
Alignment Length: | 250 | Identity: | 50/250 - (20%) |
---|---|---|---|
Similarity: | 90/250 - (36%) | Gaps: | 69/250 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 TGLPHILEHLSLCGSQKYPVRDPFFKMLNRSVATFMNAMTGPDYTIYPFSTMNEIDFR---NLQH 185
Fly 186 IYLDAVFRPNLAYFDFLQEGWRLENKDIFDKQSKLVIKGVVYN-EMKGAFSENAQVFSQNLLNNI 249
Fly 250 FPDHTYRHVSGGNPLEIPKLA---------YNDLVEFHKKYYHPSNARIYSYGLFDASKTLALLD 305
Fly 306 EEYLSDQS-W------------VDNSYS-----LIRQQ------ERWTQPRLVHI 336 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3107 | NP_001036470.1 | Cym1 | 68..1003 | CDD:223957 | 50/249 (20%) |
Peptidase_M16 | 120..>177 | CDD:279066 | 13/52 (25%) | ||
Peptidase_M16_C | 268..457 | CDD:282978 | 19/101 (19%) | ||
M16C_assoc | 531..773 | CDD:285556 | |||
CG8728 | NP_610333.1 | PqqL | 76..532 | CDD:223685 | 50/249 (20%) |
Peptidase_M16 | 104..253 | CDD:279066 | 33/150 (22%) | ||
Peptidase_M16_C | 259..461 | CDD:282978 | 17/92 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45445066 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |