DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CAPS2

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_006719711.2 Gene:CAPS2 / 84698 HGNCID:16471 Length:614 Species:Homo sapiens


Alignment Length:155 Identity:36/155 - (23%)
Similarity:65/155 - (41%) Gaps:23/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDELT-----KEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGS 61
            ||.|:     ||.| ||:......|......:.||.:        .|.||.    ||.|.::   
Human   376 SDHLSLPESIKENT-LLKLRITNIDQIALDSLKTASM--------EQEDDI----IIQETND--- 424

  Fly    62 GQIEFEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLD 126
             ::.|:....:....|.:.... ::..|.:.|:..||||||.:.....::.|:....:::..|.:
Human   425 -RLVFKAIQDVLKEKLHKRGVR-ILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFE 487

  Fly   127 MMIEEIDSDGSGTVDFDEFMEVMTG 151
            .....::.:|:|.||:.||...:.|
Human   488 SAWLILNDNGNGKVDYGEFKRGIIG 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 35/152 (23%)
CAPS2XP_006719711.2 YajQ_like <408..>444 CDD:294471 10/51 (20%)
EF-hand_7 450..510 CDD:290234 16/59 (27%)
EFh 454..510 CDD:238008 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.