DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and AT1G32250

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_174504.1 Gene:AT1G32250 / 840117 AraportID:AT1G32250 Length:166 Species:Arabidopsis thaliana


Alignment Length:166 Identity:53/166 - (31%)
Similarity:82/166 - (49%) Gaps:19/166 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIE 65
            :|.:|.:||...||..|.:||..|:|.:....:|::|..||.:........:|.:.|...:|.:|
plant     5 VSKKLDEEQINELREIFRSFDRNKDGSLTQLELGSLLRALGVKPSPDQFETLIDKADTKSNGLVE 69

  Fly    66 FEEFTTLAARFLV----------EEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKL 120
            |.||..|.:..|:          ||       :|...||::|.:|||:||...|...:.:|...|
plant    70 FPEFVALVSPELLSPAKRTTPYTEE-------QLLRLFRIFDTDGNGFITAAELAHSMAKLGHAL 127

  Fly   121 TNDDLDMMIEEIDSDGSGTVDFDEFMEVMTGG--DD 154
            |..:|..||:|.||||.|.::|.||.:.:...  ||
plant   128 TVAELTGMIKEADSDGDGRINFQEFAKAINSAAFDD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 51/158 (32%)
AT1G32250NP_174504.1 PTZ00184 8..158 CDD:185504 50/156 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.