DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CML37

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_199053.1 Gene:CML37 / 834244 AraportID:AT5G42380 Length:185 Species:Arabidopsis thaliana


Alignment Length:139 Identity:49/139 - (35%)
Similarity:70/139 - (50%) Gaps:6/139 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEEFTTLAARFL 77
            ||..|:..|...:|.|:...:.:.:|:||..|....:.:::...|.||.|.|:||||..|    :
plant    50 LRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEFLKL----M 110

  Fly    78 VEEDA--EAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEIDSDGSGTV 140
            ..||.  |....||||||.:|..||..:||...||..|..|.:..|.|...:||...|.:..|.:
plant   111 EGEDGSDEERRKELKEAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNDDGVL 175

  Fly   141 DFDEFMEVM 149
            .||||:.:|
plant   176 SFDEFVLMM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 49/139 (35%)
CML37NP_199053.1 PTZ00184 47..184 CDD:185504 48/137 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.