DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CAPS

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_004049.3 Gene:CAPS / 828 HGNCID:1487 Length:189 Species:Homo sapiens


Alignment Length:139 Identity:37/139 - (26%)
Similarity:60/139 - (43%) Gaps:29/139 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LSMLGHQLDDATLADIIAEVDEDGSGQIEFEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGN 101
            |:.||..||.|....:..:.|.:|||.::.|||    .|.|....::|..|.:..||...|:.|:
Human    50 LAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEF----LRALRPPMSQAREAVIAAAFAKLDRSGD 110

  Fly   102 GYITTGVLR-------------------EILRELDDKLTNDDLDMMI-----EEIDSDGSGTVDF 142
            |.:|...||                   |:||...|...:.:.|..:     ::..|..|.:::.
Human   111 GVVTVDDLRGVYSGRAHPKVRSGEWTEDEVLRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNT 175

  Fly   143 D-EFMEVMT 150
            | ||:.:||
Human   176 DEEFVAMMT 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 35/137 (26%)
CAPSNP_004049.3 EFh_PI-PLC 26..165 CDD:333715 30/118 (25%)
EFh 26..87 CDD:238008 14/40 (35%)
EF-hand motif 26..54 CDD:320029 1/3 (33%)
EF-hand motif 61..89 CDD:320029 9/31 (29%)
EF-hand motif 94..131 CDD:320029 9/36 (25%)
EF-hand motif 139..165 CDD:320029 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.