DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and UNE14

DIOPT Version :10

Sequence 1:NP_523619.2 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_193022.1 Gene:UNE14 / 826898 AraportID:AT4G12860 Length:152 Species:Arabidopsis thaliana


Alignment Length:142 Identity:45/142 - (31%)
Similarity:79/142 - (55%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEEFTTLAARFL 77
            |...|..||...:|.|....:......:|..:.:..:.::||::|.:|.|.::.:||.:|....:
plant     6 LSRVFQMFDKNGDGKIAKNELKDFFKSVGIMVPENEINEMIAKMDVNGDGAMDIDEFGSLYQEMV 70

  Fly    78 VEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDK--LTNDDLDMMIEEIDSDGSGTV 140
            .|::.|   .:::||||::|:.|:|:||...||.:|..:..|  .|.:|...||.::|.||.|.|
plant    71 EEKEEE---EDMREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLEDCKKMISKVDVDGDGMV 132

  Fly   141 DFDEFMEVMTGG 152
            :|.||.::|.||
plant   133 NFKEFKQMMRGG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_523619.2 PTZ00184 1..150 CDD:185504 42/138 (30%)
UNE14NP_193022.1 PTZ00184 5..141 CDD:185504 42/137 (31%)

Return to query results.
Submit another query.