DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CAM9

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_190760.1 Gene:CAM9 / 824355 AraportID:AT3G51920 Length:151 Species:Arabidopsis thaliana


Alignment Length:149 Identity:45/149 - (30%)
Similarity:81/149 - (54%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIE 65
            |:|..|.||......||...|.:.:|:|....:..::..:|.......|..::::||..|:|.|.
plant     1 MADAFTDEQIQEFYEAFCLIDKDSDGFITKEKLTKVMKSMGKNPKAEQLQQMMSDVDIFGNGGIT 65

  Fly    66 FEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIE 130
            |::|..:.|:...:|.|.   .||.|.||::|::|:|.|:...|.|.::::..|:|.::.:.|:.
plant    66 FDDFLYIMAQNTSQESAS---DELIEVFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHMVR 127

  Fly   131 EIDSDGSGTVDFDEFMEVM 149
            |.|.||.|.:.|.||.::|
plant   128 EADLDGDGFLSFHEFSKMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 45/149 (30%)
CAM9NP_190760.1 PTZ00184 1..148 CDD:185504 45/149 (30%)
EFh 12..74 CDD:238008 14/61 (23%)
EFh 85..146 CDD:238008 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.