DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and AT3G03000

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_186950.1 Gene:AT3G03000 / 821161 AraportID:AT3G03000 Length:165 Species:Arabidopsis thaliana


Alignment Length:151 Identity:55/151 - (36%)
Similarity:84/151 - (55%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEE 68
            :|..||.|.||..|.:||..|:|.:....:|::|..||.:.....|..:|.:.|.:.:|.:||.|
plant    12 KLGDEQLAELREIFRSFDQNKDGSLTELELGSLLRSLGLKPSQDQLDTLIQKADRNNNGLVEFSE 76

  Fly    69 FTTLAARFLVE----EDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMI 129
            |..|....||:    :|      :||..||::|::||||||...|...:.:|...||.::|..||
plant    77 FVALVEPDLVKCPYTDD------QLKAIFRMFDRDGNGYITAAELAHSMAKLGHALTAEELTGMI 135

  Fly   130 EEIDSDGSGTVDFDEFMEVMT 150
            :|.|.||.|.:||.||::.:|
plant   136 KEADRDGDGCIDFQEFVQAIT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 54/149 (36%)
AT3G03000NP_186950.1 PTZ00184 10..157 CDD:185504 55/151 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.