DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and AGD11

DIOPT Version :10

Sequence 1:NP_523619.2 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_187405.1 Gene:AGD11 / 819937 AraportID:AT3G07490 Length:153 Species:Arabidopsis thaliana


Alignment Length:144 Identity:50/144 - (34%)
Similarity:75/144 - (52%) Gaps:5/144 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEEFTTLAAR 75
            |.|...|..||...:|.|....:...|..||..:.|..|..:|.::|.:|.|.::.|||..|...
plant     4 AELARIFQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQMIEKIDLNGDGYVDIEEFGGLYQT 68

  Fly    76 FLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDK--LTNDDLDMMIEEIDSDGSG 138
            .:.|.|.|   .:::|||.::|:..:|:||...||.:|..|..|  .|.:|...||.::|.||.|
plant    69 IMEERDEE---EDMREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLEDCKRMISKVDVDGDG 130

  Fly   139 TVDFDEFMEVMTGG 152
            .|:|.||.::|.||
plant   131 MVNFKEFKQMMKGG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_523619.2 PTZ00184 1..150 CDD:185504 47/140 (34%)
AGD11NP_187405.1 PTZ00184 4..141 CDD:185504 47/139 (34%)

Return to query results.
Submit another query.