DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CALM2

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001292553.1 Gene:CALM2 / 805 HGNCID:1445 Length:197 Species:Homo sapiens


Alignment Length:149 Identity:67/149 - (44%)
Similarity:104/149 - (69%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEF 66
            :|:||:||.|..:.||:.||.:.:|.|.|..:||::..||....:|.|.|:|.|||.||:|.|:|
Human    50 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF 114

  Fly    67 EEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEE 131
            .||.|:.||.:.:.|:|   .|::||||::||:|||||:...||.::..|.:|||::::|.||.|
Human   115 PEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE 176

  Fly   132 IDSDGSGTVDFDEFMEVMT 150
            .|.||.|.|:::||:::||
Human   177 ADIDGDGQVNYEEFVQMMT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 65/147 (44%)
CALM2NP_001292553.1 PTZ00184 50..197 CDD:185504 67/149 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.