DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and Cabp4

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_036017598.1 Gene:Cabp4 / 73660 MGIID:1920910 Length:297 Species:Mus musculus


Alignment Length:142 Identity:51/142 - (35%)
Similarity:78/142 - (54%) Gaps:2/142 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEE 68
            ||..|:...|:.||..||.:::|||....:|..:..||:...:..|.::...|.....|.::|||
Mouse   121 ELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGFVDFEE 185

  Fly    69 FTTLAARFLVEEDAEAM-MAELKEAFRLYDKEGNGYITTGVLREILRE-LDDKLTNDDLDMMIEE 131
            |..|.:..|.||.|..: :.||:.|||.:||:.:|.||...||:.... |.:.|...:||.|:.|
Mouse   186 FVELISPKLREETAHMLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTELDEMLRE 250

  Fly   132 IDSDGSGTVDFD 143
            :|.:|.||:|||
Mouse   251 MDLNGDGTIDFD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 51/142 (36%)
Cabp4XP_036017598.1 PTZ00184 133..262 CDD:185504 45/128 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.