DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and EFCAB6

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_011528618.1 Gene:EFCAB6 / 64800 HGNCID:24204 Length:1613 Species:Homo sapiens


Alignment Length:168 Identity:36/168 - (21%)
Similarity:66/168 - (39%) Gaps:35/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RNAFNAF---DPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEEFTTL--- 72
            |:.::||   |.:::|.||...:..:|..|...|.|......:..:....|..:.|.||..|   
Human   770 RDPYSAFFKTDADRDGIINMHDLHRLLLHLLLNLKDDEFERFLGLLGLRLSVTLNFREFQNLCEK 834

  Fly    73 ----------------------------AARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVL 109
                                        |.::||.: |:...::|.:.|...|.||||.:....:
Human   835 RPWRTDEAPQRLIRPKQKVADSELACEQAHQYLVTK-AKNRWSDLSKNFLETDNEGNGILRRRDI 898

  Fly   110 REILRELDDKLTNDDLDMMIEEIDSDGSGTVDFDEFME 147
            :..|...|..||..:.:.:....|::|.|.:.:.||::
Human   899 KNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQ 936

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 36/168 (21%)
EFCAB6XP_011528618.1 EFh 100..152 CDD:298682
EF-hand_7 203..261 CDD:290234
EFh 203..261 CDD:298682
FRQ1 320..495 CDD:227455
EFh 434..494 CDD:238008
FRQ1 989..1135 CDD:227455
EF-hand_11 1186..1286 CDD:286115
EFh 1211..1264 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.