DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CABP4

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_011543483.1 Gene:CABP4 / 57010 HGNCID:1386 Length:295 Species:Homo sapiens


Alignment Length:149 Identity:53/149 - (35%)
Similarity:86/149 - (57%) Gaps:2/149 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEE 68
            ||..|:...|:.||..||.:::|||:...:|..:..||:...:..|.::...:.....|:::|||
Human   145 ELGPEELDELQAAFEEFDTDRDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMRMGGRVDFEE 209

  Fly    69 FTTLAARFLVEEDAEAM-MAELKEAFRLYDKEGNGYITTGVLREILRE-LDDKLTNDDLDMMIEE 131
            |..|....|.||.|..: :.||:.|||.:|::.:|.||...|||.:.. |.:.|...:||.|:.|
Human   210 FVELIGPKLREETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLGEPLAGPELDEMLRE 274

  Fly   132 IDSDGSGTVDFDEFMEVMT 150
            :|.:|.||||||||:.:::
Human   275 VDLNGDGTVDFDEFVMMLS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 53/147 (36%)
CABP4XP_011543483.1 PHA03415 81..>190 CDD:177643 14/44 (32%)
PTZ00184 145..294 CDD:185504 53/149 (36%)
EFh 153..214 CDD:238008 17/60 (28%)
EFh 230..293 CDD:238008 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.