DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and phf24

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_021334985.1 Gene:phf24 / 558943 ZFINID:ZDB-GENE-091204-154 Length:421 Species:Danio rerio


Alignment Length:110 Identity:26/110 - (23%)
Similarity:41/110 - (37%) Gaps:30/110 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELTKEQTALLRNAFNAFDPEKNGYINTA--MVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEF 66
            :||.|:...:...|.|.||||.|.|..:  :....||:|.....:.:|..|:...:.|       
Zfish   248 DLTDEEEEEVLAQFAALDPEKKGQIEWSDFLYHETLSVLQKFRTENSLVRILTAKERD------- 305

  Fly    67 EEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLRE 111
                  .||.|               |:..|::.:..||.|..|:
Zfish   306 ------RARAL---------------FQSIDQDKDAIITAGEARK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 26/110 (24%)
phf24XP_021334985.1 Zf_RING 136..208 CDD:293349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.