DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and cetn3

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001018335.1 Gene:cetn3 / 552931 ZFINID:ZDB-GENE-050522-152 Length:167 Species:Danio rerio


Alignment Length:148 Identity:49/148 - (33%)
Similarity:87/148 - (58%) Gaps:3/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEE 68
            |||.||...::.||..|..:|:..|:...:...:..||.::....:..|:.:.|.:|:|:|.||:
Zfish    21 ELTDEQKDEIKEAFELFGTDKDKEIDYHELKVAMRALGFEVKKVDVLKILKDYDREGTGKISFED 85

  Fly    69 FTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEID 133
            |..:....::|.|.:   .|:.:||:|:|.:..|.|:...||.:.|||.:.::::||..||:|.|
Zfish    86 FREVVTDMILERDPK---EEILKAFKLFDDDETGKISLRNLRRVARELGEDMSDEDLRAMIDEFD 147

  Fly   134 SDGSGTVDFDEFMEVMTG 151
            :||.|.::.|||:.:|||
Zfish   148 TDGDGEINQDEFISIMTG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 46/145 (32%)
cetn3NP_001018335.1 PTZ00183 13..167 CDD:185503 49/148 (33%)
EFh 29..91 CDD:238008 15/61 (25%)
EFh 102..164 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.