DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and Calm5

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001008706.1 Gene:Calm5 / 494124 MGIID:3511177 Length:140 Species:Mus musculus


Alignment Length:146 Identity:45/146 - (30%)
Similarity:78/146 - (53%) Gaps:20/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIE 65
            ||...|||:             .|:|:||...:|.::..||..|....|..:|:::|.||.|:|.
Mouse     1 MSHGFTKEE-------------NKDGHINVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKIS 52

  Fly    66 FEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIE 130
            ||||.....::..|::.:||       |.:.|:.|:||||...|:|.|.::.:.|:.::|:.||.
Mouse    53 FEEFFKSIKKYTKEQELQAM-------FSVLDQNGDGYITVDELKEGLSKMGEPLSQEELEGMIH 110

  Fly   131 EIDSDGSGTVDFDEFM 146
            ...:|..|.|::::|:
Mouse   111 VFGADQDGKVNYEQFL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 45/146 (31%)
Calm5NP_001008706.1 EFh 10..56 CDD:238008 17/45 (38%)
EFh 35..94 CDD:238008 23/65 (35%)
EF-hand_7 36..91 CDD:290234 22/61 (36%)
EFh 68..128 CDD:238008 20/66 (30%)
EF-hand_7 69..129 CDD:290234 20/65 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.