DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and tnnc1

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001004776.1 Gene:tnnc1 / 447990 XenbaseID:XB-GENE-480515 Length:161 Species:Xenopus tropicalis


Alignment Length:151 Identity:54/151 - (35%)
Similarity:89/151 - (58%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DELTKEQTALLRNAFNAF--DPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIE 65
            ::||:||....|.||:.|  |.| :|.|:|..:|.::.|||.......|.::|.||||||||.::
 Frog    10 EQLTEEQKNEFRAAFDIFVQDAE-DGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVD 73

  Fly    66 FEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIE 130
            |:||..:..|.:.::.......||.:.||::||..:|||....|:.:|....:.:|.||::.::.
 Frog    74 FDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLEATGETITEDDIEELMR 138

  Fly   131 EIDSDGSGTVDFDEFMEVMTG 151
            :.|.:..|.:|:|||:|.|.|
 Frog   139 DGDKNNDGRIDYDEFLEFMKG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 52/148 (35%)
tnnc1NP_001004776.1 PTZ00184 9..157 CDD:185504 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.