DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CG5024

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster


Alignment Length:152 Identity:43/152 - (28%)
Similarity:80/152 - (52%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIE 65
            ::||..|:..|    ||..||.:....|...::...|..:.|...:..:.|.|.|:|.||||::.
  Fly    21 LNDEQLKDCEA----AFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELY 81

  Fly    66 FEEFT-TLAARF--LVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDM 127
            ..:|. .::.|:  |..||      |:..||:::||:|:|:|.....|:|:.|..|::..|:::.
  Fly    82 LSDFLYIMSKRYENLTVED------EVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEE 140

  Fly   128 MIEEIDSDGSGTVDFDEFMEVM 149
            ||.:.|::....:|:..|:.:|
  Fly   141 MIRDADANTELKIDYVRFVTMM 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 43/152 (28%)
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 43/152 (28%)
EFh 28..90 CDD:298682 17/65 (26%)
EFh 64..127 CDD:238008 23/68 (34%)
EFh 101..163 CDD:298682 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.