DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CG31345

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_731744.1 Gene:CG31345 / 41576 FlyBaseID:FBgn0051345 Length:213 Species:Drosophila melanogaster


Alignment Length:104 Identity:22/104 - (21%)
Similarity:50/104 - (48%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QLDDATLADIIAEVDEDGSGQIEFEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTG 107
            :|.:....::...:|:|...::..:.|:..|...|          .|..:||:.|.:|:..::..
  Fly    12 ELKNLAKRELANGLDKDPIYKLRLQCFSRGATGIL----------GLSRSFRVMDDDGSKSLSPE 66

  Fly   108 VLREILRELDDKLTNDDLDMMIEEIDSDGSGTVDFDEFM 146
            ..::.:.::...||:.::|.|....|:||||.::..||:
  Fly    67 EFKKGVTDIGLDLTDSEIDEMFSRFDTDGSGNINMTEFL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 22/104 (21%)
CG31345NP_731744.1 EF-hand_7 48..105 CDD:290234 15/56 (27%)
EFh 48..105 CDD:238008 15/56 (27%)
EFh 83..136 CDD:238008 9/23 (39%)
EF-hand_7 84..144 CDD:290234 9/22 (41%)
EF-hand_7 120..190 CDD:290234
EFh 120..187 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.