DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CG11041

DIOPT Version :10

Sequence 1:NP_523619.2 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_611453.2 Gene:CG11041 / 37278 FlyBaseID:FBgn0034481 Length:155 Species:Drosophila melanogaster


Alignment Length:152 Identity:37/152 - (24%)
Similarity:78/152 - (51%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVD-EDGSGQI 64
            |..:|..:....:.:||..||...:.:|:...|||:|.:||....:..:.::|:..: |:.||::
  Fly     1 MDMDLNNDLEKRISDAFCVFDHHGDKFIDVREVGTVLRLLGCVPTEEEVNEVISATESEETSGEV 65

  Fly    65 EFEEFTTLAARFLVEEDAE-AMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMM 128
            ...:|....::.|:|...| |...::.:||::.|.|..||:|.....:::.|..:..|.:::|.|
  Fly    66 HLTKFLPHVSQLLMERKMEPAPPEKILQAFKILDPENKGYLTKESFGKLMMEEGEPFTQEEMDEM 130

  Fly   129 ----IEEIDSDGSGTVDFDEFM 146
                |:.|    ||.:.::.::
  Fly   131 WPVAIDPI----SGHIPYEFYL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_523619.2 PTZ00184 1..150 CDD:185504 37/152 (24%)
CG11041NP_611453.2 PTZ00184 15..152 CDD:185504 35/138 (25%)

Return to query results.
Submit another query.