DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and Spata21

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_006539018.1 Gene:Spata21 / 329972 MGIID:3607787 Length:688 Species:Mus musculus


Alignment Length:74 Identity:23/74 - (31%)
Similarity:35/74 - (47%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EEDAEAMMAELKEAFRLYDK--EGNGYITTGVLREILRELDDKLTNDDLDMMIEEIDSDGSGTVD 141
            |...|.:..:.:||||.|..  .|.|.:....|:.||..:....|...::..:...|.:|.|.||
Mouse   428 ERTEEHLTLKQEEAFRSYFDIFNGPGEVDARSLKNILLLIGFTFTPAQVEEALMSADVNGDGHVD 492

  Fly   142 FDEFMEVMT 150
            |.:|:.|||
Mouse   493 FKDFLAVMT 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 21/72 (29%)
Spata21XP_006539018.1 PHA03247 <5..242 CDD:223021
EFh 442..501 CDD:238008 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.