DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and Calm1

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_114175.1 Gene:Calm1 / 24242 RGDID:2257 Length:149 Species:Rattus norvegicus


Alignment Length:150 Identity:68/150 - (45%)
Similarity:105/150 - (70%) Gaps:3/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIE 65
            |:|:||:||.|..:.||:.||.:.:|.|.|..:||::..||....:|.|.|:|.|||.||:|.|:
  Rat     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65

  Fly    66 FEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIE 130
            |.||.|:.||.:.:.|:|   .|::||||::||:|||||:...||.::..|.:|||::::|.||.
  Rat    66 FPEFLTMMARKMKDTDSE---EEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIR 127

  Fly   131 EIDSDGSGTVDFDEFMEVMT 150
            |.|.||.|.|:::||:::||
  Rat   128 EADIDGDGQVNYEEFVQMMT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 66/148 (45%)
Calm1NP_114175.1 PTZ00184 1..149 CDD:185504 67/149 (45%)
Necessary and sufficient for interaction with PCP4. /evidence=ECO:0000250|UniProtKB:P0DP23 77..149 32/73 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.