DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and Phf24

DIOPT Version :10

Sequence 1:NP_523619.2 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_006537872.1 Gene:Phf24 / 230085 MGIID:2140712 Length:431 Species:Mus musculus


Alignment Length:42 Identity:13/42 - (30%)
Similarity:18/42 - (42%) Gaps:6/42 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQ 43
            |..||.||.......|.|.|||:.|::..:      ..|.|:
Mouse   268 SRALTDEQEEQAARQFAALDPEQRGHVEWS------DFLSHE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_523619.2 PTZ00184 1..150 CDD:185504 13/42 (31%)
Phf24XP_006537872.1 zf-RING_15 158..229 CDD:407013
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.