DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and K03A1.4

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001041263.2 Gene:K03A1.4 / 186916 WormBaseID:WBGene00019352 Length:184 Species:Caenorhabditis elegans


Alignment Length:140 Identity:39/140 - (27%)
Similarity:63/140 - (45%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEEFTTLAARFLV 78
            :.|||.||...:|.|....:...:...|.:.....|..|:...|.|.:|.|.|:||..|.     
 Worm    48 KRAFNFFDANNDGRITIDELEKAMQKCGQKPTKLELRLIMYHGDNDQNGVITFDEFAHLM----- 107

  Fly    79 EEDAEAMM-----AELKEAFRLYDKEGNGYITTGVLREILRE--LDDKLTNDDLDMMIEEIDSDG 136
              :..|.|     .:|:|.|.::||:.:|:|....:..|:||  |........::.:..|.|.||
 Worm   108 --NGTASMNQYTYDQLREQFDMFDKDKDGFIEKMEMLSIVRELSLQASFPRQVVEQLFNEADIDG 170

  Fly   137 SGTVDFDEFM 146
            .|.:.|:||:
 Worm   171 DGKISFEEFV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 39/140 (28%)
K03A1.4NP_001041263.2 PTZ00184 43..180 CDD:185504 38/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.