DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and cal-8

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_495043.1 Gene:cal-8 / 184373 WormBaseID:WBGene00017394 Length:145 Species:Caenorhabditis elegans


Alignment Length:141 Identity:43/141 - (30%)
Similarity:75/141 - (53%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEEFTTLAAR 75
            |.:|..|..||...:|.|....:...|..||.:..::.:..:|.:.|.||:|.|:.:||..:..|
 Worm     7 AEIREVFREFDKNGDGRITRQELEVALLQLGEKASNSKIETMIEQADLDGNGCIDIDEFLNVLRR 71

  Fly    76 FLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEIDSDGSGTV 140
            .:.:...|   .||::.|.::||.|:|.|:...|..::.:|.:|||..:...||::.|.|..|.:
 Worm    72 QICDPKEE---RELRDVFNVFDKNGDGVISIDDLIFVMCQLGEKLTETEAKEMIKQGDLDHDGMI 133

  Fly   141 DFDEFMEVMTG 151
            ||.||:.::.|
 Worm   134 DFQEFVNIIKG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 42/138 (30%)
cal-8NP_495043.1 PTZ00184 7..142 CDD:185504 42/137 (31%)
EFh 8..70 CDD:238008 17/61 (28%)
EFh 81..143 CDD:238008 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.