DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and pat-10

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_491501.1 Gene:pat-10 / 172127 WormBaseID:WBGene00003934 Length:161 Species:Caenorhabditis elegans


Alignment Length:151 Identity:64/151 - (42%)
Similarity:92/151 - (60%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFEE 68
            |:...|....:..|:|||..|.|||....:|.|:..:....|:.||..:|.:.|.||||::||:|
 Worm    11 EIDGSQIEEYQKFFDAFDRGKQGYIMATQIGQIMHGMEQDFDEKTLRKLIRKFDADGSGKLEFDE 75

  Fly    69 FTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEID 133
            |..|........|.|.:..||:|||||:||||||||:...|:.:|:|:.|.||:..|:..::|||
 Worm    76 FCALVYTVANTVDKETLEKELREAFRLFDKEGNGYISRPTLKALLKEIADDLTDQQLEEAVDEID 140

  Fly   134 SDGSGTVDFDEFMEVMTGGDD 154
            .||||.::|:||.|:|.|..|
 Worm   141 EDGSGKIEFEEFWELMAGESD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 61/145 (42%)
pat-10NP_491501.1 EFh_PEF 16..156 CDD:330173 60/139 (43%)
EF-hand motif 21..47 CDD:320054 10/25 (40%)
EF-hand motif 55..94 CDD:320054 15/38 (39%)
EF-hand motif 95..124 CDD:320054 18/28 (64%)
EF-hand motif 131..156 CDD:320054 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.