DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC41C and CALML6

DIOPT Version :9

Sequence 1:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:151 Identity:52/151 - (34%)
Similarity:83/151 - (54%) Gaps:2/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIE 65
            |::.|:.||....:..|..||.|.||.:.|..:..::|:||.....:.||.:..:||.|..|...
Human    48 MTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFN 112

  Fly    66 FEEFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIE 130
            .:.|  ||...:..|.|:...:||:.|||::||||.|||....|:.:|....:.|...:.:.|::
Human   113 CDGF--LALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMK 175

  Fly   131 EIDSDGSGTVDFDEFMEVMTG 151
            |.|.||..|:|::||:.:|||
Human   176 EADKDGDRTIDYEEFVAMMTG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 49/148 (33%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504 49/148 (33%)
EFh 59..120 CDD:238008 19/62 (31%)
EFh 133..195 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.