DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL21 and AT1G57660

DIOPT Version :9

Sequence 1:NP_001260689.1 Gene:RpL21 / 35453 FlyBaseID:FBgn0032987 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_564724.1 Gene:AT1G57660 / 842142 AraportID:AT1G57660 Length:164 Species:Arabidopsis thaliana


Alignment Length:160 Identity:82/160 - (51%)
Similarity:115/160 - (71%) Gaps:5/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIF 65
            |....|.|..|||:|:|||||.|.||||||:|.||:||.||:|.:||:.||:|:|.|||:||||:
plant     1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIW 65

  Fly    66 NVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKR 130
            |||:.||||.|||::..:|:.||::||:||:..|:|.|:|..|.|:|:.|..:||.:|:.:|.||
plant    66 NVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKR 130

  Fly   131 QPEQPKKAHFVK--KLEEPIALAPIPYEFI 158
            ||:.||....|:  .||   .:.||||:.:
plant   131 QPKGPKPGFMVEGMTLE---TVTPIPYDVV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL21NP_001260689.1 PTZ00189 1..159 CDD:240309 82/160 (51%)
AT1G57660NP_564724.1 PLN00190 1..158 CDD:177784 82/160 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 135 1.000 Domainoid score I1611
eggNOG 1 0.900 - - E1_COG2139
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128048
Inparanoid 1 1.050 172 1.000 Inparanoid score I1524
OMA 1 1.010 - - QHG53731
OrthoDB 1 1.010 - - D1455026at2759
OrthoFinder 1 1.000 - - FOG0000366
OrthoInspector 1 1.000 - - otm2937
orthoMCL 1 0.900 - - OOG6_100663
Panther 1 1.100 - - O PTHR20981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X172
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.