DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL21 and rpl2101

DIOPT Version :9

Sequence 1:NP_001260689.1 Gene:RpL21 / 35453 FlyBaseID:FBgn0032987 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_596032.1 Gene:rpl2101 / 2540950 PomBaseID:SPBC365.03c Length:160 Species:Schizosaccharomyces pombe


Alignment Length:157 Identity:91/157 - (57%)
Similarity:116/157 - (73%) Gaps:1/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIF 65
            |.:|.|.|..||..|.|.||:||.|.||||::.:|:|||||||.:||||||:|:|.||||||.::
pombe     1 MPHSYGIRARTRYTFQRGFREHGQIRLSTYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVY 65

  Fly    66 NVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKR 130
            ||||.:|||::.|.|..:.:.|||||||||:.|||||:|||.|||.||...||||.:|:.|.|:|
pombe    66 NVTQSSVGVLIYKVVGNRYMEKRVNVRIEHVKHSKCRQDFLDRVKANEAKRKEAKAQGKTVQLRR 130

  Fly   131 QPEQPKKAHFVK-KLEEPIALAPIPYE 156
            ||..|.|||||. :..||:.|.|:.|:
pombe   131 QPAPPAKAHFVSTENNEPVTLHPVAYD 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL21NP_001260689.1 PTZ00189 1..159 CDD:240309 91/157 (58%)
rpl2101NP_596032.1 PTZ00189 1..160 CDD:240309 91/157 (58%)
Ribosomal_L21e 5..97 CDD:279498 55/91 (60%)
Cdt1_c 102..>131 CDD:301324 16/28 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 129 1.000 Domainoid score I1339
eggNOG 1 0.900 - - E1_COG2139
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128048
Inparanoid 1 1.050 185 1.000 Inparanoid score I1081
OMA 1 1.010 - - QHG53731
OrthoFinder 1 1.000 - - FOG0000366
OrthoInspector 1 1.000 - - otm47206
orthoMCL 1 0.900 - - OOG6_100663
Panther 1 1.100 - - LDO PTHR20981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1117
SonicParanoid 1 1.000 - - X172
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.