DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL21 and LOC108349002

DIOPT Version :9

Sequence 1:NP_001260689.1 Gene:RpL21 / 35453 FlyBaseID:FBgn0032987 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_017446047.1 Gene:LOC108349002 / 108349002 RGDID:11468718 Length:160 Species:Rattus norvegicus


Alignment Length:160 Identity:113/160 - (70%)
Similarity:138/160 - (86%) Gaps:1/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIF 65
            |||:||.|||||.|||||||||||:||:||||::|.||||||||.|.||||:|::.|||||||::
  Rat     1 MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHECYHGKTGRVY 65

  Fly    66 NVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKR 130
            ||||||||:||||:|:|||||||:||:||||.|||.|:.||:|||||::..|||||||.||.|||
  Rat    66 NVTQHAVGIIVNKQVKGKILAKRINVQIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKR 130

  Fly   131 QPEQPKKAHFVK-KLEEPIALAPIPYEFIA 159
            ||..|::||||: ..:||..|.||.|:|:|
  Rat   131 QPWPPREAHFVRTNGKEPELLEPIQYQFMA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL21NP_001260689.1 PTZ00189 1..159 CDD:240309 112/158 (71%)
LOC108349002XP_017446047.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455026at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.