DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL21 and LOC102550668

DIOPT Version :9

Sequence 1:NP_001260689.1 Gene:RpL21 / 35453 FlyBaseID:FBgn0032987 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_038954123.1 Gene:LOC102550668 / 102550668 RGDID:7700714 Length:155 Species:Rattus norvegicus


Alignment Length:155 Identity:103/155 - (66%)
Similarity:127/155 - (81%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIF 65
            |||:|..|||||.:||||||||||:||.||||::|.||||||||.||.|||:.:|.|||||.|::
  Rat     1 MTNTKVKRRGTRYVFSRPFRKHGVVPLVTYMRLYKKGDIVDIKGMGAAQKGMTHKCYHGKTVRVY 65

  Fly    66 NVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKR 130
            ||||||||:||||:|:|||||||:||.||||.|||.|:.||::||||::..:||||||.||.|..
  Rat    66 NVTQHAVGIIVNKQVKGKILAKRINVWIEHIKHSKSRDSFLKQVKENDQKKEEAKEKGTWVQLSL 130

  Fly   131 QPEQPKKAHFVK-KLEEPIALAPIP 154
            ||..|::||||: ..:||..|.|:|
  Rat   131 QPAPPREAHFVRTNGKEPELLEPVP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL21NP_001260689.1 PTZ00189 1..159 CDD:240309 103/155 (66%)
LOC102550668XP_038954123.1 PTZ00189 1..155 CDD:240309 102/153 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341587
Domainoid 1 1.000 175 1.000 Domainoid score I3539
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 244 1.000 Inparanoid score I3206
OMA 1 1.010 - - QHG53731
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000366
OrthoInspector 1 1.000 - - otm45256
orthoMCL 1 0.900 - - OOG6_100663
Panther 1 1.100 - - O PTHR20981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X172
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.