DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3262 and CFD1

DIOPT Version :9

Sequence 1:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_012263.1 Gene:CFD1 / 854814 SGDID:S000001265 Length:293 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:91/280 - (32%)
Similarity:148/280 - (52%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGE 92
            |:|... :.|::.||::.|||||||||:|....|.:|..:|.:||:||.|:.||::|.:..:..|
Yeast     7 GVPAAS-LAGIKHIILILSGKGGVGKSSVTTQTALTLCSMGFKVGVLDIDLTGPSLPRMFGLENE 70

  Fly    93 PVVNDKNLMIPPQNY---NVKCLSMGMLTPVE---------TSVIWRGPLVMSAIQRLLKGTDWG 145
            .:...      |:.:   .|:..|.|.|:.:.         .|||||||...|.|::.:....||
Yeast    71 SIYQG------PEGWQPVKVETNSTGSLSVISLGFLLGDRGNSVIWRGPKKTSMIKQFISDVAWG 129

  Fly   146 LLDVLVIDTPPGTGDVHLSLSQ---HAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVE 207
            .||.|:|||||||.|.|:|:::   ::...|.|:||||.:.|.....|..:..:|:::.|.|::|
Yeast   130 ELDYLLIDTPPGTSDEHISIAEELRYSKPDGGIVVTTPQSVATADVKKEINFCKKVDLKILGIIE 194

  Fly   208 NMKYTICQNCNQRLEFFKD---SRIS---SLPRKLISLPLDSRIADSNESGV----PVVIKYPDS 262
            ||...:|.:|.:....|..   .|:|   |:| .|.::|:|.:..:..|:.|    .:|..|.:|
Yeast   195 NMSGFVCPHCAECTNIFSSGGGKRLSEQFSVP-YLGNVPIDPKFVEMIENQVSSKKTLVEMYRES 258

  Fly   263 KYSYLFTQLAEEITQILNEQ 282
            ....:|    |||.:.|.:|
Yeast   259 SLCPIF----EEIMKKLRKQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 85/262 (32%)
minD_arch 41..281 CDD:131024 87/264 (33%)
CFD1NP_012263.1 ParA 15..271 CDD:402307 87/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.