DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3262 and NBP35

DIOPT Version :9

Sequence 1:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_568748.1 Gene:NBP35 / 835169 AraportID:AT5G50960 Length:350 Species:Arabidopsis thaliana


Alignment Length:281 Identity:92/281 - (32%)
Similarity:142/281 - (50%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGEPVVNDKNLMI 102
            |:..|:|.||||||||||.:...:.:||.:..:|||:|.||.||:||.::.:.|:. ::..||..
plant    58 VKHKILVLSGKGGVGKSTFSAQLSFALAGMDHQVGLMDIDICGPSIPKMLGLEGQE-IHQSNLGW 121

  Fly   103 PP--QNYNVKCLSMGMLTP-VETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHLS 164
            .|  ...|:..:|:|.:.| .:.:||||||.....|::.||...||.:|.||:|.||||.|.|:|
plant   122 SPVYVEDNLGVMSIGFMLPNSDEAVIWRGPRKNGLIKQFLKDVYWGEIDYLVVDAPPGTSDEHIS 186

  Fly   165 LSQH---APITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFKD 226
            :.|:   ..|.|.|:||||...::....|..|..:|:.||:.||||||     ...:|.|:..|.
plant   187 IVQYLLPTGIDGAIIVTTPQEVSLIDVRKEVSFCKKVGVPVLGVVENM-----SGLSQPLKDVKF 246

  Fly   227 SRISSLPRKLISLPLD------------------SRIADSN---------ESGVPVVIKYP-DSK 263
            .::::.....|::..|                  |.:.||:         |.|||.:.|.| |.:
plant   247 MKLATETGSSINVTEDVIACLRKNAPELLDIVACSEVFDSSGGGAERMCREMGVPFLGKVPMDPQ 311

  Fly   264 YSYLFTQLAEEITQILNEQRC 284
                ..:.||:......:.:|
plant   312 ----LCKAAEQGKSCFEDNKC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 91/270 (34%)
minD_arch 41..281 CDD:131024 90/273 (33%)
NBP35NP_568748.1 ParA 58..343 CDD:402307 92/281 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.