DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3262 and NUBPL

DIOPT Version :9

Sequence 1:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_079428.2 Gene:NUBPL / 80224 HGNCID:20278 Length:319 Species:Homo sapiens


Alignment Length:266 Identity:118/266 - (44%)
Similarity:173/266 - (65%) Gaps:7/266 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QVKLMARGLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLA--KLGKRVGLLDGDIFGPTI 83
            :.::|:|||||::||.||:.:||||||||||||||.|||.|.:||  ...|.:||||.|::||::
Human    49 RTQIMSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPSV 113

  Fly    84 PLLMNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLD 148
            |.:||:.|.|.::..|||.|..||.:.|:|||.|......|:|||.:|||||::||:..|||.||
Human   114 PKMMNLKGNPELSQSNLMRPLLNYGIACMSMGFLVEESEPVVWRGLMVMSAIEKLLRQVDWGQLD 178

  Fly   149 VLVIDTPPGTGDVHLSLSQHAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTI 213
            .||:|.|||||||.||:||:.||||.::|:||...|:....|||.|:.:::||:.|:|:||....
Human   179 YLVVDMPPGTGDVQLSVSQNIPITGAVIVSTPQDIALMDAHKGAEMFRRVHVPVLGLVQNMSVFQ 243

  Fly   214 CQNCNQRLEFFKDSRISSLPRK-----LISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAE 273
            |..|..:...|.......|.:.     |..:||...|.:::::|.|:|...|:|..:..:.::|.
Human   244 CPKCKHKTHIFGADGARKLAQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAV 308

  Fly   274 EITQIL 279
            |:.:.|
Human   309 EVVRRL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 108/244 (44%)
minD_arch 41..281 CDD:131024 108/246 (44%)
NUBPLNP_079428.2 ParA 65..311 CDD:287566 109/245 (44%)
minD_arch 69..311 CDD:131024 107/241 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151441
Domainoid 1 1.000 217 1.000 Domainoid score I2689
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11854
Inparanoid 1 1.050 238 1.000 Inparanoid score I3377
Isobase 1 0.950 - 0 Normalized mean entropy S1527
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 1 1.000 - - FOG0005727
OrthoInspector 1 1.000 - - oto89333
orthoMCL 1 0.900 - - OOG6_100169
Panther 1 1.100 - - LDO PTHR42961
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5312
SonicParanoid 1 1.000 - - X4124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.