DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3262 and Nubp2

DIOPT Version :9

Sequence 1:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001011891.1 Gene:Nubp2 / 287125 RGDID:1305113 Length:271 Species:Rattus norvegicus


Alignment Length:256 Identity:87/256 - (33%)
Similarity:143/256 - (55%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IIGVQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGEPVVNDKN 99
            :.||:.||:|.||||||||||::...|.:|...||:||:||.|:.||:||.:::..|:.|....:
  Rat    10 LAGVRHIILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHMLHAQGKAVHQCDS 74

  Fly   100 LMIP---PQNYNVKCLSMGML--TPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTG 159
            ..:|   .|..::..:|:|.|  .|.| :|:||||...:.|::.:....||.||.||:||||||.
  Rat    75 GWVPVFVDQEQSISLMSVGFLLENPDE-AVVWRGPKKHALIKQFVSDVAWGELDYLVVDTPPGTS 138

  Fly   160 DVHL----SLSQHAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQR 220
            |.|:    :|..:.|: |.::||||...::....:..:..:|..:.:.||:|||....|.:|.:.
  Rat   139 DEHMATVEALRPYKPL-GALVVTTPQAVSIGDVRRELTFCKKTGLQVIGVIENMSGFACPHCAEC 202

  Fly   221 LEFFKD------SRISSLPRKLISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEI 275
            ...|..      :|::.:| .|.|:|||.::..|.|.|...:.::|.|......|.:|.::
  Rat   203 TNVFSSGGGEELARLAGVP-FLGSVPLDPQLTRSLEEGRDFIQEFPKSTAYSALTSIAHKV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 87/252 (35%)
minD_arch 41..281 CDD:131024 85/250 (34%)
Nubp2NP_001011891.1 ParA 12..263 CDD:287566 87/254 (34%)
FlhG 15..263 CDD:223531 85/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.