DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3262 and SPAC637.08

DIOPT Version :9

Sequence 1:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_594626.1 Gene:SPAC637.08 / 2543416 PomBaseID:SPAC637.08 Length:317 Species:Schizosaccharomyces pombe


Alignment Length:282 Identity:96/282 - (34%)
Similarity:147/282 - (52%) Gaps:32/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RGLPKKQPII-----GVQDIIVVASGKGGVGKSTVAVNFACSLA-KLGKRVGLLDGDIFGPTIPL 85
            ||.....|::     .::..|:|.||||||||||.:...|..|: :..|::||:|.||.||:||.
pombe    43 RGEDPDLPLVVERLKEIKHKILVLSGKGGVGKSTFSSQLAWGLSLEEDKQIGLMDVDICGPSIPR 107

  Fly    86 LMNVHGEPVVNDKN----LMIPPQNYNVKCLSMGMLTPVE-TSVIWRGPLVMSAIQRLLKGTDWG 145
            :|.|..|.......    :.:.|   |:..:|:|.|.|.| :|||||||.....|::.:|..:|.
pombe   108 IMGVEKEEAHQSSKGWSPIYVCP---NLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWE 169

  Fly   146 LLDVLVIDTPPGTGDVHLSLSQ---HAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVE 207
            .||.|::||||||.|.||||.|   ::.|.|.::||||...|:|...|......|.::||.|:||
pombe   170 NLDYLIVDTPPGTSDEHLSLVQFFKNSGIDGAVVVTTPQEVALQDVRKEIDFCRKASIPILGLVE 234

  Fly   208 NMKYTICQNCNQRLEFF-----------KDSRISSLPRKLISLPLDSRIADSNESGVPVVIKYPD 261
            ||...:|.:|..:...|           |:..:..|.:    :|||..||.|.:.|...:.:.|:
pombe   235 NMSGFVCPSCKGKSNIFTITTGGGEALAKEMGLPFLGK----IPLDPLIARSCDFGKSFIDECPE 295

  Fly   262 SKYSYLFTQLAEEITQILNEQR 283
            |..|.:...:..:|.:.|.:::
pombe   296 SPASEIIIDIINKIDESLQKRQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 91/257 (35%)
minD_arch 41..281 CDD:131024 93/259 (36%)
SPAC637.08NP_594626.1 Mrp 16..283 CDD:223563 89/246 (36%)
ParA 59..300 CDD:287566 90/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.