DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3262 and SPAC806.02c

DIOPT Version :9

Sequence 1:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_592852.1 Gene:SPAC806.02c / 2542122 PomBaseID:SPAC806.02c Length:608 Species:Schizosaccharomyces pombe


Alignment Length:279 Identity:93/279 - (33%)
Similarity:137/279 - (49%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSL--AKLGKR---VGLLDGDIFGPTIPLLMNVHGE----- 92
            ||.:|:|.|||||||||:|....|.||  :|:..|   .|:||.|:.||:||.:.....|     
pombe     4 VQHVILVLSGKGGVGKSSVTTQLALSLHDSKVYSRPLKTGILDIDLTGPSIPRMFGKDAERNRIH 68

  Fly    93 -------PVVNDKNLMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDV 149
                   ||..|       :...:..:|:| :||....||:||||...:.|::.:....||.||.
pombe    69 QSSAGWVPVYTD-------ETKEIGLMSLGFLLTSKNDSVVWRGPKKAAMIRQFISDVSWGELDF 126

  Fly   150 LVIDTPPGTGDVHLSLSQ----------HAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFG 204
            |:|||||||||.||::.:          ..||.|.::||||...|.....|.....:|.::.|.|
pombe   127 LIIDTPPGTGDEHLTIVESLLSETSTVRDVPIDGAVIVTTPQGIATLDVQKEIDFCKKASIKILG 191

  Fly   205 VVENMKYTICQNCNQRLEFFKDSRISSLPRK-----LISLPLDSRIADSNESGVPVVIKYPDSKY 264
            :||||...||.:|......|......:|..|     |.|:|:|.:..:..|:      ..|||..
pombe   192 IVENMSGYICPHCADCTNIFSSGGGLTLSEKYKLPFLGSVPIDPKFGEMIEN------LTPDSNI 250

  Fly   265 SYLF--TQLAEEITQILNE 281
            .:|:  |:::::.:.|.||
pombe   251 VHLYSKTEMSKKFSFITNE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 90/271 (33%)
minD_arch 41..281 CDD:131024 89/274 (32%)
SPAC806.02cNP_592852.1 ParA 3..269 CDD:287566 91/277 (33%)
COG1149 8..246 CDD:224071 83/250 (33%)
WD40 <283..608 CDD:225201
WD40 283..606 CDD:238121
WD40 repeat 293..330 CDD:293791
WD40 repeat 337..376 CDD:293791
WD40 repeat 381..420 CDD:293791
WD40 repeat 427..464 CDD:293791
WD40 repeat 470..507 CDD:293791
WD40 repeat 534..575 CDD:293791
WD40 repeat 582..605 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.