DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir94e

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001097885.2 Gene:Ir94e / 42765 FlyBaseID:FBgn0259194 Length:611 Species:Drosophila melanogaster


Alignment Length:588 Identity:106/588 - (18%)
Similarity:185/588 - (31%) Gaps:225/588 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YLLGLLNSTRLTFIGNDESDTAI-----ALTQIVRGLQQ--SSLAILALPSLALSDGVCQKERNV 69
            |.|....|.||..:| ..||..:     .||.:|..|:.  :|..|..:.|.|.:|.:.:..||.
  Fly    79 YFLHNSISRRLVTLG-FMSDANLDEHRGLLTALVANLRHMTTSRVIFLVQSKASTDFLYELFRNC 142

  Fly    70 YLDDFLQRLHRSNYKSVV-----FSQTELFFQH-------IEE------------------NLQG 104
            :         |....:|:     |..|..|:.:       |||                  ||.|
  Fly   143 W---------RKKLLNVIVIFQDFETTSTFYSYSNFPILQIEERIYETSLQTLPIFPDRLRNLHG 198

  Fly   105 ANECISL------ILDEPNQLLNSLHDRHLGHRLSLFIFYWGARWPPSSRVIRFREPLRV----- 158
            ....:.|      ::...|:..|.::|..:||.::.|         .....::|.:||:.     
  Fly   199 YEMPVILGGTAPRMIAYRNKKGNVVYDGTVGHFMTAF---------QQKYNVKFVQPLQAKNPLD 254

  Fly   159 -------------------VVVTRPRKKAFRIYYNQARPCSDSQLQLVNW-----YDGDNLGLQR 199
                               :.:|.|....|...|         ..:.:||     .:.|      
  Fly   255 FAPSMQTVGAVRNETVEISISLTFPTIPPFGFSY---------PYEQMNWCVMLPVEAD------ 304

  Fly   200 IP--------------------------LLPTALSVYA----------------NFKGRTFRVPV 222
            :|                          ||.:|||::.                ...|::| |.|
  Fly   305 VPPFEYYTRVFELAAFLLTLGTLVLISCLLASALSLHGYATNISEFLLHDSCLRGVLGQSF-VEV 368

  Fly   223 FHSP------------------PWF------WVTYCNNSFEEDEEFNSLDSIEKRKVRVTGGRDH 263
            |.:|                  .|:      :||    |..:...|.:.|.|...|::|...:. 
  Fly   369 FRAPTLVRGIYLEICVLGILITAWYNSYFSSYVT----SAPKQPPFRTYDDILASKLKVVAWKP- 428

  Fly   264 RLLMLLSKHMNFRFKY-----IEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGL 323
            ....|:.:.:.|| ||     :|.......::|     |:.|:..|  .::.:.:          
  Fly   429 EYAELVGRLLEFR-KYETMFLVEPDFNRYLALR-----DTLDTRYG--YMITTNR---------- 475

  Fly   324 SW----ERRKAIEFSFFTLADSGAFATHAP--RRLNEALAIMRPFKQ--------DIWPHLILT- 373
             |    |::|......|...|...|..:.|  ..|:|....|.|.::        .::.|.|.| 
  Fly   476 -WVLINEQQKVFSRPLFQKRDDFCFFNNIPFGFPLHENSVFMEPVQKLIMELAETGLYYHWITTG 539

  Fly   374 ---IIFSGPIFYGIIALPYIWRRRWANSDVEHLGELYIHMTYLKEITPRLLKL----KPRTVLSA 431
               :|.:|.:.: :...|:...|.....|::::...|..|..|..:...|..|    |.:|:...
  Fly   540 FSELIDAGEMHF-VDLSPHREFRAMQIQDLQYVWYGYAFMVVLSSLVWLLENLAYTVKSKTIFPT 603

  Fly   432 HQM 434
            |.|
  Fly   604 HFM 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 28/154 (18%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 20/111 (18%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725
Ir94eNP_001097885.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.