DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir92a

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:449 Identity:97/449 - (21%)
Similarity:169/449 - (37%) Gaps:125/449 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 GLLQSGQADFFLGDVGLSWERR------------KAIEFSFFTLADSG-AFATHAPRRLNEALAI 358
            |:..:..:|..|||:   :|:|            ..|..:..|:|.|. .....||..|......
  Fly   315 GIYDNESSDGMLGDI---YEQRVEMAIGCIYNWYDGITETSHTIARSSVTILGPAPAPLPSWRTN 376

  Fly   359 MRPFKQDIWPHLILTIIFSGPIFYGIIALPYI-WRRRWANSDVEHLGELYIHMTYLKEITPRLLK 422
            :.||....|..||.|::..|...|   .:.|: :|.|::.:.|:     :.|...|::....:..
  Fly   377 IMPFNNRAWLVLISTLVICGTFLY---FMKYVSYRLRYSGTQVK-----FHHSRKLEKSMLDIFA 433

  Fly   423 L---KPRTVLSAHQMPHQLFQKCIWFTLRLFLKQSCNELHNGYRAKFLTIVYWIAATYVLADVYS 484
            |   :|...||        |.:   |..|.||               .||   :.||..|.::||
  Fly   434 LFIQQPSAPLS--------FDR---FAPRFFL---------------ATI---LCATITLENIYS 469

  Fly   485 AQLTSQFARPAREPPINTLQRLQAAMIHDGYR------LYVEK-ESSSLE---MLENGTELFRQL 539
            .||.|....|....|::|:::    ....|::      ::|.. :||.||   :|....|:..  
  Fly   470 GQLKSMLTFPFYSAPVDTIEK----WAQSGWKWSAPSIIWVHTVQSSDLETEQILARNFEVHD-- 528

  Fly   540 YALMRQQVINDPQGFFID-----SVEAGIKLIAEGGEDKAVLGGRETLFFNVQQYGSNNFQLSQK 599
            |:.:.........||.|:     |:..|..:..|..|::.||  .:.|:|:              
  Fly   529 YSYLSNVSFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVL--HDDLYFD-------------- 577

  Fly   600 LYTRYSAVAVQIGCPFLGSLNNVLMQLFESGI--------LDKMTAAEYAKQYQEVEATRIYKGS 656
             |||  ||::: |...:..||..:....|:|:        :||....:..:...::......||:
  Fly   578 -YTR--AVSIR-GWILMPELNKHIRTCQETGLYFHWELEFIDKYMDKKKQEVLMDLANGHKVKGA 638

  Fly   657 VQAKNSEAYSRTESYDSTVISPLNLRMLQGAFIALGVGSLAAGVILLLEIVFIKLDQAR 715
            .||                   |::|.:.||...|..|...||..|:.|::..::|.::
  Fly   639 PQA-------------------LDVRNIAGALFVLAFGVAFAGCALVAELLIHRMDLSK 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 8/42 (19%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 23/97 (24%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 34/163 (21%)
Ir92aNP_001097845.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.