DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir87a

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:237 Identity:48/237 - (20%)
Similarity:83/237 - (35%) Gaps:40/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 YVLADVYSAQLTSQFARPAREPPINTLQRLQA-AMIHDGYRLYVEKESSSLEMLENGTELFRQLY 540
            :..::.|.:.|.|....|.....|:|||.:.: .|...|...:|...:...|:.:...|.|:..|
  Fly   570 FFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCY 634

  Fly   541 ALMRQQVINDPQGFFIDSVEAGIKLIAEGGEDKAVLGGRETLFFN--VQQYGSNNFQLSQKLYTR 603
            .|:  ..:||                |...|..||...|:..|:|  :|:.....|...:.||..
  Fly   635 NLV--DCLND----------------AAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESLYVY 681

  Fly   604 YSAVAVQIGCPFLGSLNNVLMQLFESGILDKMTAAEYAKQYQEVEATRIYKGSVQAKNSEAYSRT 668
            ...:.:......|..:|.|:..:.|||.:.|.......::....|.||:.:...:|         
  Fly   682 LVTMLLPKKYHLLHQINPVIQHIIESGHMQKWARDLDMRRMIHEEITRVREDPFKA--------- 737

  Fly   669 ESYDSTVISPLNLRMLQGAFIALGVGSLAAGVILLLEIVFIK 710
                      |.....:||....|...|.|..:...|:.::|
  Fly   738 ----------LTFDQFRGAIAFSGGLLLVASCVFAFELCYVK 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 32/143 (22%)
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.