DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and GluRIA

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster


Alignment Length:445 Identity:91/445 - (20%)
Similarity:167/445 - (37%) Gaps:120/445 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 GGIGLLQSGQADFFLGDVGLSWERRKAIEFS--FFTLADS-----------GAFATHAPRRLNEA 355
            |.:|.|...:||..:..:.::.||.:.|:||  |.||..|           |.|           
  Fly   550 GMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVF----------- 603

  Fly   356 LAIMRPFKQDIWPHLILTIIFSGPIFYGIIAL-PYIW---RRRWANSDVEH---------LGELY 407
             :.:.|..|:||..:||:.:....:.|.:... ||.|   ||..|:|..:.         |.|..
  Fly   604 -SFLNPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQ 667

  Fly   408 IHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQKCIWFTLRLFLKQSCNELHNGYRAKFLTIVYW 472
            .|   :..:.|...     |:|::           .|::|..|::|.|:........:....|:|
  Fly   668 AH---VPPVPPNEF-----TMLNS-----------FWYSLAAFMQQGCDITPPSIAGRIAAAVWW 713

  Fly   473 IAATYVLADVYSAQLTSQFARPAREPPINTLQRLQAAMIHDGYRLYVEKESSSLEM---LENGTE 534
            . .|.:|...|:|.|.:          ..|::|:.|.:          |....|.|   :..||.
  Fly   714 F-FTIILISSYTANLAA----------FLTVERMVAPI----------KTPEDLTMQTDVNYGTL 757

  Fly   535 LFRQLYALMRQ----------QVINDPQGFFIDSVEAGIKLIAEG-GEDKAVLGGRETLFFNVQQ 588
            |:...:...|:          :.:|..|...:.:.:.||:.:.:. |:...::...:..:.|.:.
  Fly   758 LYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARP 822

  Fly   589 YGSNNFQLSQKLYTRYSAVAVQIGCPFLGSLNNVLMQLFESGILDKMTAAEYAKQYQEVEATRIY 653
             ..:..::.:.:.|:...||..||.|....||..::.|.|:|                 |..|| 
  Fly   823 -PCDTMKVGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENG-----------------ELLRI- 868

  Fly   654 KGSVQAKNSEAYSRTE-SYDSTVISP--LNLRMLQGAFIALGVGSLAAGVILLLE 705
                  :|...:.:|| :.|....:|  |:|..:.|.:..|..|.|.|.::.::|
  Fly   869 ------RNKWWFDKTECNLDQETSTPNELSLSNVAGIYYILIGGLLLAVIVAIME 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 11/35 (31%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 25/100 (25%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 27/154 (18%)
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 80/405 (20%)
Lig_chan 612..907 CDD:278489 69/359 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.