DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir60a

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster


Alignment Length:476 Identity:89/476 - (18%)
Similarity:167/476 - (35%) Gaps:141/476 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 GRDHRLLMLLSKHMNFRFKYIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGLS 324
            |.:.|:|..:...:.|..       ....|:.|....|...::||.:|.:|:.:.||..|  |..
  Fly   289 GLEMRILGFMKNRLKFDV-------NQTCSLESRGEMDGPANWTGLLGKVQNNECDFVFG--GYY 344

  Fly   325 WERRKAIEF--SFFTLADSGAFATHAPRRLNEALAIMRPFKQDIWPHLILTIIFSGPIFYGII-A 386
            .:...|..|  |...|.|:..:......|.....|::..|:...|...||.:|.|...::.:: .
  Fly   345 PDNEVADHFWGSDTYLQDAHTWYIKMADRRPAWQALVGIFEAYTWIGFILILIISWLFWFTLVMI 409

  Fly   387 LPYIWRRRWANSDVEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQKCIWFTLRLFL 451
            ||                    ...|.::::...:.....|:..|.|      ::.|..|.||| 
  Fly   410 LP--------------------EPKYYQQLSLTAINALAVTISIAVQ------ERPICETTRLF- 447

  Fly   452 KQSCNELHNGYRAKFLTIVYW---IAATYVLADVYSAQLTSQFARPAREPPINTLQRLQAAMI-- 511
                          |:.:..:   :.||      |::::.:.|..|.....::.|..:.||.|  
  Fly   448 --------------FMALTLYGLNVVAT------YTSKMIATFQDPGYLHQLDELTEVVAAGIPF 492

  Fly   512 --HDGYRLYVEKESSSLEMLENGTELFRQLYALMRQQVINDPQGFFIDSVEAGIKLIAEGGEDKA 574
              |:..|.:.|.:...  .:.||..:..:..          ||...:::|:.|.:.|        
  Fly   493 GGHEESRDWFENDDDM--WIFNGYNISPEFI----------PQSKNLEAVKWGQRCI-------- 537

  Fly   575 VLGGRETLFFNVQQYGSNNFQLSQKLYTRYSAVA------------------VQIGCPFLGSLNN 621
                                 ||.::||..|.:|                  ::.|.|||..:|:
  Fly   538 ---------------------LSNRMYTMQSPLADVIYAFPNNVFSSPVQMIMKAGFPFLFEMNS 581

  Fly   622 VLMQLFESGILDKMTAAEYAKQYQEVEATRIYKGSVQAKNSEAYSRTESYDSTVISPLNLRMLQG 686
            ::..:.:.||..|:. |::  :|......||.|           .|.:..::.::  |....|:|
  Fly   582 IIRLMRDVGIFQKID-ADF--RYNNTYLNRINK-----------MRPQFPETAIV--LTTEHLKG 630

  Fly   687 AFIALGVGSLAAGVILLLEIV 707
            .|..|.|||..|.:..:.|::
  Fly   631 PFFILVVGSCWAALTFIGELI 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 18/79 (23%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 24/96 (25%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 28/162 (17%)
Ir60aNP_611901.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.