DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir56b

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:516 Identity:102/516 - (19%)
Similarity:178/516 - (34%) Gaps:157/516 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 FKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLDSIEKRKV---RVTGGRDHRLLMLLSKHMN 274
            |....|.||.|..|....|.:....:......:||:|:.|:.|   .:..|:.:     ||.|  
  Fly    26 FNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDIISGKYN-----LSLH-- 83

  Fly   275 FRFKYIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGLSWERRKAIEFSF-FTL 338
                                          |:.:.....:|||           .|.:.|: ..|
  Fly    84 ------------------------------GVIIRPEETSDFF-----------NATQHSYPLEL 107

  Fly   339 ADSGAFATHAPRRLNEALAIMRPFKQDIWPHLILTIIFSGPIFYGIIALPYIWRRRWANSDVEHL 403
            ..:......|| .|.:.:.::.|..:.||     |.:|.| .||..:.|.|:..|...|:...: 
  Fly   108 MTNCVMVPLAP-ELPKWMYMVWPLGKYIW-----TCLFLG-TFYVALLLRYVHWREPGNATRSY- 164

  Fly   404 GELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQKCIWFTLRLFLKQSCNELHNGYRA-KFL 467
                                 .|.||  |.|...:|...:..:::|        .|...|. .|.
  Fly   165 ---------------------TRNVL--HAMALLMFSANMNMSVKL--------KHASIRVIIFY 198

  Fly   468 TIVYWIAATYVLADVYSAQLTSQFARPAREPPINTLQRLQAAMIHDGYRLYVEKESSSLEMLENG 532
            |::|...  ::|.:.:.:.:|:...:|....||:|...|    ||...|:.:  ..|.||.|.  
  Fly   199 TLLYIFG--FILTNYHLSHMTAFDMKPVFLRPIDTWSDL----IHSRLRIVI--HDSLLEELR-- 253

  Fly   533 TELFRQLYALMRQQVINDPQGFFIDSVEAGIKLIAEGGEDKAVLGGRET-LFFN------VQQYG 590
                                  ::...:|   |:|......|.:..::. ||||      :|.| 
  Fly   254 ----------------------WLPVYQA---LLASPSRSYAYVVTQDAWLFFNRQQKVLIQPY- 292

  Fly   591 SNNFQLSQKLY-TRYSAVAVQIGCPFLGSLNNVLMQLFESGILDKMTAAEYAKQYQEVEATRIYK 654
               |.||:..: ..::|:.:.....|..|||..::.::::|:.:..  .|.|.:|.|        
  Fly   293 ---FHLSKVCFGGLFNALPMASNASFADSLNKFILNVWQAGLWNYW--EELAFRYAE-------- 344

  Fly   655 GSVQAKNSEAYSRTESYDSTVISPLNLRMLQGAFIALGVGSLAAGVILLLEIVFIKLDQAR 715
               ||..::.:     .|:..:.||||.....|:|.|..|...:.:...||:...:..|.|
  Fly   345 ---QAGYAKVF-----LDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELFIHRRKQRR 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 21/125 (17%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 20/94 (21%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 30/148 (20%)
Ir56bNP_611430.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.