DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and gria3b

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_938174.1 Gene:gria3b / 368416 ZFINID:ZDB-GENE-030616-53 Length:883 Species:Danio rerio


Alignment Length:539 Identity:107/539 - (19%)
Similarity:201/539 - (37%) Gaps:134/539 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 FWVTYCNNSFEE-----DEEF-NSLDSIEKRKVRVTGGRDHRLLMLLSKHMNFRFKYIEAPGRTQ 287
            :|     |.||.     |::| |...|:|.|.:.||...:...:|....||     ::|...:.:
Zfish   388 YW-----NEFERFVNIMDQQFTNDSSSVENRTIVVTTIMEAPYVMYKKNHM-----HLEGNEKYE 442

  Fly   288 G---SMRSE---------------DGK-----DSNDSFTGGIGLLQSGQADFFLGDVGLSWERRK 329
            |   .:.||               |||     ....|:.|.:|.|..|:||..:..:.::..|.:
Zfish   443 GYCVDLASEIAKHVGIKYRLSIVMDGKYGARDPETKSWNGMVGELVYGRADIAVAPLTITLVREE 507

  Fly   330 AIEFS--FFTLADSGAFATHAPRRLNEAL-AIMRPFKQDIWPHLILTIIFSGPIFYGIIALPYIW 391
            .|:||  |.:|..|  .....|::....: :.:.|...:||    :.|:|:   :.|:..:.::.
Zfish   508 VIDFSKPFMSLGIS--IMIKKPQKSKPGVFSFLDPLAYEIW----MCIVFA---YIGVSVVLFLV 563

  Fly   392 RR----RWANSDVEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQ--LFQKCIWFTLRLF 450
            .|    .|...:.:.:.:                   |:|   ....|:.  :|.. :||:|..|
Zfish   564 SRFSPYEWQLDETDEVKD-------------------PQT---PPDPPNDFGIFNS-LWFSLGAF 605

  Fly   451 LKQSCNELHNGYRAKFLTIVYWIAATYVLADVYSAQLTSQFARPAREPPINTLQRLQAAMIHDGY 515
            ::|.|:........:.:..|:|. .|.::...|:|.|.:.........||.:.:.|         
Zfish   606 MQQGCDISPRSLSGRIVGGVWWF-FTLIIISSYTANLAAFLTVERMVSPIESAEDL--------- 660

  Fly   516 RLYVEKESSSLEMLENGT--ELFRQ----LYALMRQQVINDPQGFFIDSVEAGIKLIAEGGEDKA 574
               .::...:...|::|:  |.||:    :|..|...:.:.....|..:...|:..:.:.....|
Zfish   661 ---AKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFA 722

  Fly   575 VLGGRETLFFNVQQYGSNNFQLSQKLYTRYSAVAVQIGCPFLGSLNNVLMQLFESGILDKMTAAE 639
            .|.......:..|:...:..::...|.::...||...|.....::|..:::|.|.|:|||:    
Zfish   723 FLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKL---- 783

  Fly   640 YAKQYQEVEATRIYKGSVQAKNSEAYSRTE-------SYDSTVISPLNLRMLQGAFIALGVGSLA 697
                                ||...|.:.|       |.|.|  |.|:|..:.|.|..| ||.|.
Zfish   784 --------------------KNKWWYDKGECGSGGGDSKDKT--SALSLSNVAGVFYIL-VGGLG 825

  Fly   698 -AGVILLLEIVFIKLDQAR 715
             |.::.|:|..:....:|:
Zfish   826 LAMMVALIEFCYKSRAEAK 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 34/139 (24%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 21/96 (22%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 26/146 (18%)
gria3bNP_938174.1 Periplasmic_Binding_Protein_Type_1 25..396 CDD:299141 4/12 (33%)
ANF_receptor 36..379 CDD:279440
PBP2_iGluR_AMPA 412..794 CDD:270433 81/455 (18%)
Lig_chan 544..824 CDD:278489 64/349 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.