DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir94a

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster


Alignment Length:351 Identity:69/351 - (19%)
Similarity:107/351 - (30%) Gaps:120/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VVFSQTELFFQHIEENLQGAN------------ECISLILDEPNQLLN--SLHDRHLGHRLSLFI 136
            ::|...|:.|..|.....|.|            ..:..||.:.:.:.|  ||..:|....:|||.
  Fly   311 IIFVLVEMLFVFISNRFNGRNFTMRYTNPLINLRAVRAILGQTSPISNRYSLSIQHFFVFMSLFG 375

  Fly   137 FYWGARWPPSSRVIRFREPLRVVVVTRPRKKAFRIYYNQARPCSDSQLQLVNWYDGDNLGLQRIP 201
            ..:|.         .|...||..:..||       ||:|                          
  Fly   376 TLFGG---------FFDCKLRSFLTKRP-------YYSQ-------------------------- 398

  Fly   202 LLPTALSVYANFKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLDSIEKRKVRVTGGRDHRLL 266
                 :..::..:.....|.|.|:...|.....|.:|..||..|         ||.|      .:
  Fly   399 -----IENFSELRKSGVTVVVDHTTRQFIEQEINANFFRDEVPN---------VRTT------TI 443

  Fly   267 MLLSKHM-----NFRFKYIEAPGRT-QGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGLSW 325
            ..|..|:     .|.|.....|.|| :..|:|.:.|...||  ..:.:|::....|.:       
  Fly   444 QELINHVYSYDRKFAFVANSIPWRTFREEMKSINQKILCDS--KNLTILENVPLTFSI------- 499

  Fly   326 ERRKAIEFS------FFTLADSG-----------AFATHAPRRLNEA------LAIMRPFKQDIW 367
             ||.|| ||      ....||||           ....|....|.|:      |.:.....:.:|
  Fly   500 -RRNAI-FSHHLRNFIINAADSGMITCWFKMAGKVIRKHIKTTLRESEQQPSHLPLSFDHFKWLW 562

  Fly   368 PHLILTIIFSGPIFYGIIALPYIWRR 393
            ..|.:..:.|..:|    .:..:|.:
  Fly   563 AVLCIAYVMSFMVF----VMEILWSK 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 32/133 (24%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 22/116 (19%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725
Ir94aNP_732699.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.