DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir7b

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:459 Identity:100/459 - (21%)
Similarity:169/459 - (36%) Gaps:96/459 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 DSNDSFTGGIGLLQSGQADFFLGDVGLSWERRKAIEFSFFTLADSG-----AFATHA-------- 348
            |.:.||.|..|.|....|:.....|||.|..::.:   ..|..:||     .|..||        
  Fly   228 DGSGSFVGIEGALLQFMAENLNFTVGLYWMNKEEV---LATFDESGRIFDEIFGHHADFSLGGFH 289

  Fly   349 --PRRLNEALAIMRPFKQDIW---PHLIL-TIIFSGPIFYGIIALPY---IWRRRWANSDVEHLG 404
              |...:|.     |:.|..:   .|::| |.:.|....|..::.|:   :||.         :|
  Fly   290 FKPSAGSEI-----PYSQSTYYFMSHIMLVTNLQSAYSAYEKLSFPFTPLLWRA---------IG 340

  Fly   405 ELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQKCIWFTLRLFLKQSCNELHNGYRAKFLTI 469
            .:.|       :...||.|..|. ...|::|...:.:.:..|:...|:..........|...|| 
  Fly   341 LVLI-------LACLLLMLLVRW-RHHHELPRNPYYELLVLTMGGNLEDRWVPQRFPSRLVLLT- 396

  Fly   470 VYWIAATYVLADVYSAQLTSQFARPAREPPINTLQRLQAAMIHDGYRLYVEKESSSLEMLE-NGT 533
              |:.||.||...|.:.:.....:..:..|..|:..:.|             :..::::.| |..
  Fly   397 --WLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLA-------------QHFTIQLAEVNEA 446

  Fly   534 ELFRQLYALMRQQVINDPQGFFIDSVEAGIKLIAEGGEDK--AVLGGRETL--FFNVQQYGSNNF 594
            .:...|..|..:|::. .:|..:.|..|   |..:.|...  |:|...|..  |..|........
  Fly   447 RILASLPELRPEQLVY-LEGSELQSFPA---LAQQSGSSARVAILTPYEYFGYFRKVHPMSRRLH 507

  Fly   595 QLSQKLYTRYSAVAVQIGCPFLGSLNNVLMQLFESGILDKMTAAEYAKQYQEVEATRIYKGSVQA 659
            .:.:::||:..|..|:.....:|.||..:......|.|:..|     :||  |.|......||..
  Fly   508 LVRERIYTQQLAFYVRRHSHLVGVLNKQIQHAHTHGFLEHWT-----RQY--VSAVDEKDESVAR 565

  Fly   660 KNSEAYSR----------TESYDSTVISP-----LNLRMLQGAFIALGVGSLAAGVILLLEIVF- 708
            ..|.:||.          :||.:...::|     |::|.|...|..:...:|.|.|:.:||::. 
  Fly   566 IASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLILWANLGAVVVFVLELLLP 630

  Fly   709 -IKL 711
             |||
  Fly   631 RIKL 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 11/40 (28%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 27/115 (23%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 27/145 (19%)
Ir7bNP_572410.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.